GPA33 (NM_005814) Human Mass Spec Standard
CAT#: PH310225
GPA33 MS Standard C13 and N15-labeled recombinant protein (NP_005805)
View other "GPA33" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GPA33 MS Standard C13 and N15-labeled recombinant protein (NP_005805) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210225 |
Predicted MW | 35.6 kDa |
Protein Sequence |
>RC210225 protein sequence
Red=Cloning site Green=Tags(s) MVGKMWPVLWTLCAVRVTVDAISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVV IWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVP PSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYI CTSSNEEGTQFCNITVAVRSPSMNVALYVGIAVGVVAALIIIGIIIYCCCCRGKDDNTEDKEDARPNREA YEEPPEQLRELSREREEEDDYRQEEQRSTGRESPDHLDQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005805 |
RefSeq Size | 2793 |
RefSeq ORF | 957 |
Synonyms | A33 |
Locus ID | 10223 |
Cytogenetics | 1q24.1 |
Summary | The glycoprotein encoded by this gene is a cell surface antigen that is expressed in greater than 95% of human colon cancers. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. The sequence of the extracellular region contains 2 domains characteristic of the CD2 subgroup of the immunoglobulin (Ig) superfamily. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417048 | GPA33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417048 | Transient overexpression lysate of glycoprotein A33 (transmembrane) (GPA33) |
CNY 3,080.00 |
|
TP310225 | Recombinant protein of human glycoprotein A33 (transmembrane) (GPA33), 20 µg |
CNY 2,900.00 |
|
TP720397 | Purified recombinant protein of Homo sapiens glycoprotein A33 (transmembrane) (GPA33) |
CNY 1,800.00 |
|
TP762369 | Purified recombinant protein of Human glycoprotein A33 (transmembrane) (GPA33), Ile22-Val235-GGGGS-Tyr257-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |