FABP2 (NM_000134) Human Mass Spec Standard
CAT#: PH310206
FABP2 MS Standard C13 and N15-labeled recombinant protein (NP_000125)
View other "FABP2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | FABP2 MS Standard C13 and N15-labeled recombinant protein (NP_000125) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210206 |
Predicted MW | 15.2 kDa |
Protein Sequence |
>RC210206 protein sequence
Red=Cloning site Green=Tags(s) MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFN YNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000125 |
RefSeq Size | 2271 |
RefSeq ORF | 396 |
Synonyms | FABPI; I-FABP |
Locus ID | 2169 |
Cytogenetics | 4q26 |
Summary | The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. [provided by RefSeq, Aug 2017] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424906 | FABP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424906 | Transient overexpression lysate of fatty acid binding protein 2, intestinal (FABP2) |
CNY 3,080.00 |
|
TP310206 | Recombinant protein of human fatty acid binding protein 2, intestinal (FABP2), 20 µg |
CNY 2,900.00 |
|
TP720115 | Recombinant protein of human fatty acid binding protein 2, intestinal (FABP2) |
CNY 3,140.00 |