Carboxylesterase 7 (CES5A) (NM_145024) Human Mass Spec Standard
CAT#: PH310205
CES7 MS Standard C13 and N15-labeled recombinant protein (NP_659461)
View other "Carboxylesterase 7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CES7 MS Standard C13 and N15-labeled recombinant protein (NP_659461) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210205 |
Predicted MW | 58 kDa |
Protein Sequence |
>RC210205 representing NM_145024
Red=Cloning site Green=Tags(s) MSGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSPVPVNVFLGVPFAAPPLGSL RFTNPQPASPWDNLREATSYPNLCLQNSEWLLLDQHMLKVHYPKFGVSEDCLYLNIYAPAHADTGSKLPV LVWFPGGAFKTGSASIFDGSALAAYEDVLVVVVQYRLGIFGFFTTWDQHAPGNWAFKDQVAALSWVQKNI EFFGGDPSSVTIFGESAGAISVSSLILSPMAKGLFHKAIMESGVAIIPYLEAHDYEKSEDLQVVAHFCGN NASDSEALLRCLRTKPSKELLTLSQKTKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLL PMKEAPEILSGSNKSLALHLIQNILHIPPQYLHLVANEYFHDKHSLTEIRDSLLDLLGDVFFVVPALITA RYHREGATEEEKLLSRKMMKYWATFARTGNPNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVDFWT STIPLILSASDMLHSPLSSLTFLSLLQPFFFFCAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_659461 |
RefSeq Size | 1962 |
RefSeq ORF | 1575 |
Synonyms | CAUXIN; CES4C1; CES5; CES7; HEL126 |
Locus ID | 221223 |
Cytogenetics | 16q12.2 |
Summary | This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They also participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This gene, also called CES5, is predominantly expressed in peripheral tissues, including brain, kidney, lung and testis. It encodes a secreted enzyme. Because of high levels in the urine of male domestic cats, this enzyme is also called cauxin (carboxylesterase-like urinary excreted protein). The enzyme functions in regulating the production of a pheromone precursor and may contribute to lipid and cholesterol transfer processes within male reproductive fluids. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408085 | CES5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408085 | Transient overexpression lysate of carboxylesterase 7 (CES7), transcript variant 2 |
CNY 3,080.00 |
|
TP310205 | Recombinant protein of human carboxylesterase 7 (CES7), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Carboxylesterase 7产品