Carboxylesterase 7 (CES5A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CES7 antibody: synthetic peptide directed towards the N terminal of human CES7. Synthetic peptide located within the following region: SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	carboxylesterase 5A
Database Link	NP_659461 Entrez Gene 221223 Human UniProt ID Q6NT32
Background	CES7 Belongs to the type-B carboxylesterase/lipase family and involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.
Synonyms	CAUXIN; CES4C1; CES5; CES7; HEL126
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Drug metabolism - other enzymes

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.