IFNA21 (NM_002175) Human Mass Spec Standard
CAT#: PH310115
IFNA21 MS Standard C13 and N15-labeled recombinant protein (NP_002166)
View other "IFNA21" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | IFNA21 MS Standard C13 and N15-labeled recombinant protein (NP_002166) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210115 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC210115 protein sequence
Red=Cloning site Green=Tags(s) MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQ FQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSI LAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002166 |
RefSeq Size | 1024 |
RefSeq ORF | 567 |
Synonyms | IFN-alphaI; leIF-F; LeIF F |
Locus ID | 3452 |
Cytogenetics | 9p21.3 |
Summary | This gene is a member of the alpha interferon gene cluster on the short arm of chromosome 9. Interferons are cytokines produced in response to viral infection that mediate the immune response and interfere with viral replication. The encoded protein is a type I interferon and may play a specific role in the antiviral response to rubella virus. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419491 | IFNA21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419491 | Transient overexpression lysate of interferon, alpha 21 (IFNA21) |
CNY 3,080.00 |
|
TP310115 | Recombinant protein of human interferon, alpha 21 (IFNA21), 20 µg |
CNY 2,900.00 |