MOX1 (MEOX1) (NM_004527) Human Mass Spec Standard
CAT#: PH310106
MEOX1 MS Standard C13 and N15-labeled recombinant protein (NP_004518)
View other "MOX1" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | MEOX1 MS Standard C13 and N15-labeled recombinant protein (NP_004518) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210106 |
Predicted MW | 28 kDa |
Protein Sequence |
>RC210106 protein sequence
Red=Cloning site Green=Tags(s) MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAAT PHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGST ANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDL SERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004518 |
RefSeq Size | 2330 |
RefSeq ORF | 762 |
Synonyms | KFS2; MOX1 |
Locus ID | 4222 |
Cytogenetics | 17q21.31 |
Summary | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417902 | MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC421872 | MEOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY417902 | Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY421872 | Transient overexpression lysate of mesenchyme homeobox 1 (MEOX1), transcript variant 3 |
CN¥ 3,080.00 |
|
TP310106 | Recombinant protein of human mesenchyme homeobox 1 (MEOX1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |