PRAP1 (NM_145202) Human Mass Spec Standard
CAT#: PH310031
PRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_660203)
View other "PRAP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_660203) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210031 |
Predicted MW | 17.2 kDa |
Protein Sequence |
>RC210031 protein sequence
Red=Cloning site Green=Tags(s) MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKL LTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGP EEDQDHIYHPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660203 |
RefSeq Size | 807 |
RefSeq ORF | 453 |
Synonyms | PRO1195; UPA |
Locus ID | 118471 |
Cytogenetics | 10q26.3 |
Summary | May play an important role in maintaining normal growth homeostasis in epithelial cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407941 | PRAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428749 | PRAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407941 | Transient overexpression lysate of proline-rich acidic protein 1 (PRAP1), transcript variant 1 |
CNY 3,080.00 |
|
LY428749 | Transient overexpression lysate of proline-rich acidic protein 1 (PRAP1), transcript variant 2 |
CNY 3,080.00 |
|
PH327420 | PRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001138673) |
CNY 14,250.00 |
|
TP310031 | Recombinant protein of human proline-rich acidic protein 1 (PRAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327420 | Purified recombinant protein of Homo sapiens proline-rich acidic protein 1 (PRAP1), transcript variant 2, 20 µg |
CNY 2,900.00 |