POLD4 (NM_021173) Human Mass Spec Standard
CAT#: PH309992
POLD4 MS Standard C13 and N15-labeled recombinant protein (NP_066996)
View other "POLD4" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | POLD4 MS Standard C13 and N15-labeled recombinant protein (NP_066996) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209992 |
Predicted MW | 12.4 kDa |
Protein Sequence |
>RC209992 protein sequence
Red=Cloning site Green=Tags(s) MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRW CRAKHMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066996 |
RefSeq Size | 1751 |
RefSeq ORF | 321 |
Synonyms | p12; POLDS |
Locus ID | 57804 |
Cytogenetics | 11q13.2 |
Summary | This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012] |
Protein Pathways | Base excision repair, DNA replication, Homologous recombination, Metabolic pathways, Mismatch repair, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412048 | POLD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY412048 | Transient overexpression lysate of polymerase (DNA-directed), delta 4 (POLD4) |
CN¥ 3,080.00 |
|
TP309992 | Recombinant protein of human polymerase (DNA-directed), delta 4 (POLD4), 20 µg |
CN¥ 2,900.00 |