PTP4A2 (NM_080391) Human Mass Spec Standard
CAT#: PH309983
PTP4A2 MS Standard C13 and N15-labeled recombinant protein (NP_536316)
View other "PTP4A2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PTP4A2 MS Standard C13 and N15-labeled recombinant protein (NP_536316) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209983 |
Predicted MW | 19.1 kDa |
Protein Sequence |
>RC209983 protein sequence
Red=Cloning site Green=Tags(s) MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS KQLLYLEKYRPKMRLRFRDTNGHCCVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_536316 |
RefSeq Size | 3939 |
RefSeq ORF | 501 |
Synonyms | HH7-2; HH13; HU-PP-1; OV-1; PRL-2; PRL2; ptp-IV1a; ptp-IV1b; PTP4A; PTPCAAX2 |
Locus ID | 8073 |
Cytogenetics | 1p35.2 |
Summary | The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17. [provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409184 | PTP4A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409184 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1 |
CNY 3,080.00 |
|
TP309983 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, 20 µg |
CNY 2,900.00 |