SPARC (NM_003118) Human Mass Spec Standard
CAT#: PH309964
SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109)
View other "SPARC" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209964 |
Predicted MW | 34.6 kDa |
Protein Sequence |
>RC209964 protein sequence
Red=Cloning site Green=Tags(s) MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY IALDEWAGCFGIKQKDIDKDLVI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003109 |
RefSeq Size | 3604 |
RefSeq ORF | 909 |
Synonyms | BM-40; OI17; ON; ONT |
Locus ID | 6678 |
Cytogenetics | 5q33.1 |
Summary | This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418873 | SPARC HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY418873 | Transient overexpression lysate of secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) |
CN¥ 3,080.00 |
|
TP309964 | Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC), 20 µg |
CN¥ 2,900.00 |
|
TP720332 | Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) |
CN¥ 3,140.00 |