ErbB 3 (ERBB3) (NM_001982) Human Mass Spec Standard
CAT#: PH309954
ERBB3 MS Standard C13 and N15-labeled recombinant protein (NP_001973)
View other "ErbB 3" proteins (14)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ERBB3 MS Standard C13 and N15-labeled recombinant protein (NP_001973) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209954 |
Predicted MW | 148.1 kDa |
Protein Sequence |
>RC209954 representing NM_001982
Red=Cloning site Green=Tags(s) MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGH NADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLT EILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTIC APQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKY QYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDG FVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPR RDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPME GTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCL GQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVL ARIFKETELRKLKVLGSGVFGTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAH IVRLLGLCPGSSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAE PYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELANEFTRMARDPPRYLVIKR ESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNLATTTLGSALSLPVGTLNRPRGSQSLLSP SSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSR SRSPRPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEE EDEDEEYEYMNRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWH SRLFPKANAQRT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001973 |
RefSeq Size | 5511 |
RefSeq ORF | 4026 |
Synonyms | c-erbB-3; c-erbB3; ErbB-3; erbB3-S; FERLK; HER3; LCCS2; MDA-BF-1; p45-sErbB3; p85-sErbB3; p180-ErbB3 |
Locus ID | 2065 |
Cytogenetics | 12q13.2 |
Summary | This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Druggable Genome, Protein Kinase, Secreted Protein, Stem cell - Pluripotency, Transmembrane |
Protein Pathways | Calcium signaling pathway, Endocytosis, ErbB signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400725 | ERBB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423671 | ERBB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425161 | ERBB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400725 | Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1 |
CNY 3,080.00 |
|
LY423671 | Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s |
CNY 3,080.00 |
|
LY425161 | Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s |
CNY 3,080.00 |
|
PH324398 | ERBB3 MS Standard C13 and N15-labeled recombinant protein (NP_001005915) |
CNY 19,520.00 |
|
TP309954 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP324398 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s, 20 µg |
CNY 2,900.00 |
|
TP700010 | Recombinant extracellular domain of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, expressed in human cells |
CNY 6,650.00 |
|
TP700106 | Purified recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP710089 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP710091 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, residues 20-643, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP723990 | Human HER3 Protein, His Tag |
CNY 5,249.00 |