INSL3 (NM_005543) Human Mass Spec Standard
CAT#: PH309944
INSL3 MS Standard C13 and N15-labeled recombinant protein (NP_005534)
View other "INSL3" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | INSL3 MS Standard C13 and N15-labeled recombinant protein (NP_005534) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209944 |
Predicted MW | 14.5 kDa |
Protein Sequence |
>RC209944 protein sequence
Red=Cloning site Green=Tags(s) MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWL ERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005534 |
RefSeq Size | 833 |
RefSeq ORF | 393 |
Synonyms | ley-I-L; RLF; RLNL |
Locus ID | 3640 |
Cytogenetics | 19p13.11 |
Summary | This gene encodes a member of the insulin-like hormone superfamily. The encoded protein is mainly produced in gonadal tissues. Studies of the mouse counterpart suggest that this gene may be involved in the development of urogenital tract and female fertility. This protein may also act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent. Mutations in this gene may lead to cryptorchidism. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417236 | INSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417236 | Transient overexpression lysate of insulin-like 3 (Leydig cell) (INSL3) |
CNY 3,080.00 |
|
TP309944 | Recombinant protein of human insulin-like 3 (Leydig cell) (INSL3), 20 µg |
CNY 2,900.00 |
|
TP721235 | Purified recombinant protein of Human insulin-like 3 (Leydig cell) (INSL3) |
CNY 3,140.00 |