DNAJC19 (NM_145261) Human Mass Spec Standard
CAT#: PH309910
DNAJC19 MS Standard C13 and N15-labeled recombinant protein (NP_660304)
View other "DNAJC19" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DNAJC19 MS Standard C13 and N15-labeled recombinant protein (NP_660304) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209910 |
Predicted MW | 12.5 kDa |
Protein Sequence |
>RC209910 protein sequence
Red=Cloning site Green=Tags(s) MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVS PTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660304 |
RefSeq Size | 1476 |
RefSeq ORF | 348 |
Synonyms | PAM18; TIM14; TIMM14 |
Locus ID | 131118 |
Cytogenetics | 3q26.33 |
Summary | The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407987 | DNAJC19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407987 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19) |
CNY 3,080.00 |
|
TP309910 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 19 (DNAJC19), 20 µg |
CNY 2,900.00 |
其它DNAJC19产品