RHOB (NM_004040) Human Mass Spec Standard
CAT#: PH309837
RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031)
View other "RHOB" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209837 |
Predicted MW | 22.1 kDa |
Protein Sequence |
>RC209837 protein sequence
Red=Cloning site Green=Tags(s) MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004031 |
RefSeq Size | 2384 |
RefSeq ORF | 588 |
Synonyms | ARH6; ARHB; MST081; MSTP081; RHOH6 |
Locus ID | 388 |
Cytogenetics | 2p24.1 |
Summary | Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418297 | RHOB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418297 | Transient overexpression lysate of ras homolog gene family, member B (RHOB) |
CNY 3,080.00 |
|
TP309837 | Recombinant protein of human ras homolog gene family, member B (RHOB), 20 µg |
CNY 2,900.00 |
|
TP701009 | Purified recombinant protein of Human ras homolog gene family, member B (RHOB), mutant (S73F), expressed in HEK293 cells, 20ug |
CNY 6,650.00 |