TIMP2 (NM_003255) Human Mass Spec Standard
CAT#: PH309796
TIMP2 MS Standard C13 and N15-labeled recombinant protein (NP_003246)
View other "TIMP2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TIMP2 MS Standard C13 and N15-labeled recombinant protein (NP_003246) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209796 |
Predicted MW | 24.4 kDa |
Protein Sequence |
>RC209796 protein sequence
Red=Cloning site Green=Tags(s) MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQ YEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQ KKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP KQEFLDIEDP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003246 |
RefSeq Size | 3670 |
RefSeq ORF | 660 |
Synonyms | CSC-21K; DDC8 |
Locus ID | 7077 |
Cytogenetics | 17q25.3 |
Summary | This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418809 | TIMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418809 | Transient overexpression lysate of TIMP metallopeptidase inhibitor 2 (TIMP2) |
CNY 3,080.00 |
|
TP309796 | Recombinant protein of human TIMP metallopeptidase inhibitor 2 (TIMP2), 20 µg |
CNY 2,900.00 |
|
TP720667 | Purified recombinant protein of Human TIMP metallopeptidase inhibitor 2 (TIMP2) |
CNY 1,800.00 |