TPK1 (NM_022445) Human Mass Spec Standard
CAT#: PH309721
TPK1 MS Standard C13 and N15-labeled recombinant protein (NP_071890)
View other "TPK1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TPK1 MS Standard C13 and N15-labeled recombinant protein (NP_071890) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209721 |
Predicted MW | 27.2 kDa |
Protein Sequence |
>RC209721 protein sequence
Red=Cloning site Green=Tags(s) MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_071890 |
RefSeq Size | 2449 |
RefSeq ORF | 729 |
Synonyms | HTPK1; PP20; THMD5 |
Locus ID | 27010 |
Cytogenetics | 7q35 |
Summary | The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5. [provided by RefSeq, Apr 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Thiamine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411708 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420935 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411708 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 1 |
CNY 3,080.00 |
|
LY420935 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 2 |
CNY 3,080.00 |
|
TP309721 | Recombinant protein of human thiamin pyrophosphokinase 1 (TPK1), transcript variant 1, 20 µg |
CNY 2,900.00 |