TTDA (GTF2H5) (NM_207118) Human Mass Spec Standard
CAT#: PH309579
GTF2H5 MS Standard C13 and N15-labeled recombinant protein (NP_997001)
View other "TTDA" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | GTF2H5 MS Standard C13 and N15-labeled recombinant protein (NP_997001) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209579 |
Predicted MW | 8.1 kDa |
Protein Sequence |
>RC209579 protein sequence
Red=Cloning site Green=Tags(s) MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQ K myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_997001 |
RefSeq Size | 7503 |
RefSeq ORF | 213 |
Synonyms | bA120J8.2; C6orf175; TFB5; TFIIH; TGF2H5; TTD; TTD-A; TTD3; TTDA |
Locus ID | 404672 |
Cytogenetics | 6q25.3 |
Summary | This gene encodes a subunit of transcription/repair factor TFIIH, which functions in gene transcription and DNA repair. This protein stimulates ERCC3/XPB ATPase activity to trigger DNA opening during DNA repair, and is implicated in regulating cellular levels of TFIIH. Mutations in this gene result in trichothiodystrophy, complementation group A. [provided by RefSeq, Mar 2009] |
Protein Families | Transcription Factors |
Protein Pathways | Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403721 | GTF2H5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403721 | Transient overexpression lysate of general transcription factor IIH, polypeptide 5 (GTF2H5) |
CNY 3,080.00 |
|
TP309579 | Recombinant protein of human general transcription factor IIH, polypeptide 5 (GTF2H5), 20 µg |
CNY 2,900.00 |