SKP1 (NM_170679) Human Mass Spec Standard
CAT#: PH309385
SKP1 MS Standard C13 and N15-labeled recombinant protein (NP_733779)
View other "SKP1" proteins (6)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SKP1 MS Standard C13 and N15-labeled recombinant protein (NP_733779) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209385 |
Predicted MW | 18.5 kDa |
Protein Sequence |
>RC209385 representing NM_170679
Red=Cloning site Green=Tags(s) MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPP PPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFN IKNDFTEEEEAQVRKENQWCEEK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_733779 |
RefSeq Size | 1486 |
RefSeq ORF | 489 |
Synonyms | EMC19; OCP-II; OCP2; p19A; SKP1A; TCEB1L |
Locus ID | 6500 |
Cytogenetics | 5q31.1 |
Summary | This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, TGF-beta signaling pathway, Ubiquitin mediated proteolysis, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406907 | SKP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC416315 | SKP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY406907 | Transient overexpression lysate of S-phase kinase-associated protein 1 (SKP1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY416315 | Transient overexpression lysate of S-phase kinase-associated protein 1 (SKP1), transcript variant 1 |
CN¥ 3,080.00 |
|
TP309385 | Recombinant protein of human S-phase kinase-associated protein 1 (SKP1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP760600 | Purified recombinant protein of Human S-phase kinase-associated protein 1 (SKP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |