CAVIN1 (NM_012232) Human Mass Spec Standard
CAT#: PH309277
PTRF MS Standard C13 and N15-labeled recombinant protein (NP_036364)
View other "CAVIN1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PTRF MS Standard C13 and N15-labeled recombinant protein (NP_036364) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209277 |
Predicted MW | 43.3 kDa |
Protein Sequence |
>RC209277 representing NM_012232
Red=Cloning site Green=Tags(s) MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQL TQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEV NEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSDEAVEVE EVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTR LVPAERREKLKTSXDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDE GGAERGEAGDLRRGSSPDVHALLEITEESDAVLVDKSDSD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036364 |
RefSeq Size | 3580 |
RefSeq ORF | 1170 |
Synonyms | CAVIN; cavin-1; CGL4; FKSG13; PTRF |
Locus ID | 284119 |
Cytogenetics | 17q21.2 |
Summary | This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3' end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy. [provided by RefSeq, Nov 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402171 | PTRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402171 | Transient overexpression lysate of polymerase I and transcript release factor (PTRF) |
CNY 3,080.00 |
|
TP309277 | Recombinant protein of human polymerase I and transcript release factor (PTRF), 20 µg |
CNY 2,900.00 |