Leptin (LEP) (NM_000230) Human Mass Spec Standard
CAT#: PH309259
LEP MS Standard C13 and N15-labeled recombinant protein (NP_000221)
View other "Leptin" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | LEP MS Standard C13 and N15-labeled recombinant protein (NP_000221) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209259 |
Predicted MW | 18.6 kDa |
Protein Sequence |
>RC209259 protein sequence
Red=Cloning site Green=Tags(s) MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPIL TLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGY STEVVALSRLQGSLQDMLWQLDLSPGC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000221 |
RefSeq Size | 3444 |
RefSeq ORF | 501 |
Synonyms | LEPD; OB; OBS |
Locus ID | 3952 |
Cytogenetics | 7q32.1 |
Summary | This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Adipocytokine signaling pathway, Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400087 | LEP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400087 | Transient overexpression lysate of leptin (LEP) |
CN¥ 3,080.00 |
|
TP309259 | Recombinant protein of human leptin (LEP), 20 µg |
CN¥ 2,900.00 |
|
TP720054 | Recombinant protein of human leptin (LEP) |
CN¥ 1,800.00 |