Carbonic Anhydrase IV (CA4) (NM_000717) Human Mass Spec Standard
CAT#: PH309229
CA4 MS Standard C13 and N15-labeled recombinant protein (NP_000708)
View other "Carbonic Anhydrase IV" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CA4 MS Standard C13 and N15-labeled recombinant protein (NP_000708) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209229 |
Predicted MW | 35.03 kDa |
Protein Sequence |
>RC209229 representing NM_000717
Red=Cloning site Green=Tags(s) MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRF FFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMH IVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPK EEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRT VIKSGAPGRPLPWALPALLGPMLACLLAGFLR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000708 |
RefSeq Size | 1104 |
RefSeq ORF | 936 |
Synonyms | CAIV; Car4; RP17 |
Locus ID | 762 |
Cytogenetics | 17q23.1 |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This gene encodes a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, it may have a role in inherited renal abnormalities of bicarbonate transport. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424546 | CA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424546 | Transient overexpression lysate of carbonic anhydrase IV (CA4) |
CNY 3,080.00 |
|
TP309229 | Recombinant protein of human carbonic anhydrase IV (CA4), 20 µg |
CNY 2,900.00 |
|
TP720090 | Recombinant protein of human carbonic anhydrase IV (CA4) |
CNY 3,140.00 |
其它Carbonic Anhydrase IV产品