WNT5A (NM_003392) Human Mass Spec Standard
CAT#: PH309206
WNT5A MS Standard C13 and N15-labeled recombinant protein (NP_003383)
View other "WNT5A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | WNT5A MS Standard C13 and N15-labeled recombinant protein (NP_003383) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209206 |
Predicted MW | 42.3 kDa |
Protein Sequence |
>RC209206 protein sequence
Red=Cloning site Green=Tags(s) MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCS QLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYA VSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS YESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNS RGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTV QTERCHCKFHWCCYVKCKKCTEIVDQFVCK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003383 |
RefSeq Size | 6194 |
RefSeq ORF | 1140 |
Synonyms | hWNT5A |
Locus ID | 7474 |
Cytogenetics | 3p14.3 |
Summary | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway |
Protein Pathways | Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401155 | WNT5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401155 | Transient overexpression lysate of wingless-type MMTV integration site family, member 5A (WNT5A) |
CNY 3,080.00 |
|
TP309206 | Recombinant protein of human wingless-type MMTV integration site family, member 5A (WNT5A), 20 µg |
CNY 2,900.00 |