United States
Germany
Japan
United Kingdom
China
Myelin Basic Protein (MBP) (NM_001025100) Human Mass Spec Standard
CAT＃: PH309071
MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020271)
View other "Myelin Basic Protein" proteins (21)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020271) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209071 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC209071 protein sequence
Red=Cloning site Green=Tags(s) MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRT ADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRP SQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKVSSEE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001020271 |
| RefSeq Size | 4889 |
| RefSeq ORF | 591 |
| Locus ID | 4155 |
| Cytogenetics | 18q23 |
| Summary | The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called "Golli-MBP") that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422581 | MBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422582 | MBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422584 | MBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422587 | MBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422588 | MBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425478 | MBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422581 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 1 |
CNY 3,080.00 |
|
| LY422582 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 3 |
CNY 3,080.00 |
|
| LY422584 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 4 |
CNY 3,080.00 |
|
| LY422587 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 8 |
CNY 3,080.00 |
|
| LY422588 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 7 |
CNY 3,080.00 |
|
| LY425478 | Transient overexpression lysate of myelin basic protein (MBP), transcript variant 1 |
CNY 3,080.00 |
|
| PH300710 | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020261) |
CNY 19,520.00 |
|
| PH310291 | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020263) |
CNY 19,520.00 |
|
| PH315746 | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020252) |
CNY 19,520.00 |
|
| PH321469 | MBP MS Standard C13 and N15-labeled recombinant protein (NP_001020272) |
CNY 14,250.00 |
|
| TP300710 | Recombinant protein of human myelin basic protein (MBP), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP309071 | Recombinant protein of human myelin basic protein (MBP), transcript variant 8, 20 µg |
CNY 2,900.00 |
|
| TP310291 | Recombinant protein of human myelin basic protein (MBP), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP315746 | Recombinant protein of human myelin basic protein (MBP), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP321469 | Purified recombinant protein of Homo sapiens myelin basic protein (MBP), transcript variant 7, 20 µg |
CNY 2,900.00 |
其它Myelin Basic Protein产品
