ORC6L (ORC6) (NM_014321) Human Mass Spec Standard
CAT#: PH309054
ORC6L MS Standard C13 and N15-labeled recombinant protein (NP_055136)
View other "ORC6L" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ORC6L MS Standard C13 and N15-labeled recombinant protein (NP_055136) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209054 |
Predicted MW | 28.1 kDa |
Protein Sequence |
>RC209054 protein sequence
Red=Cloning site Green=Tags(s) MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIK LSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLF TSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAK EMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055136 |
RefSeq Size | 1644 |
RefSeq ORF | 756 |
Synonyms | ORC6L |
Locus ID | 23594 |
Cytogenetics | 16q11.2 |
Summary | The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Cell cycle |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415362 | ORC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY415362 | Transient overexpression lysate of origin recognition complex, subunit 6 like (yeast) (ORC6L) |
CN¥ 3,080.00 |
|
TP309054 | Recombinant protein of human origin recognition complex, subunit 6 like (yeast) (ORC6L), 20 µg |
CN¥ 2,900.00 |