MFAP4 (NM_002404) Human Mass Spec Standard
CAT#: PH308999
MFAP4 MS Standard C13 and N15-labeled recombinant protein (NP_002395)
View other "MFAP4" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MFAP4 MS Standard C13 and N15-labeled recombinant protein (NP_002395) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208999 |
Predicted MW | 28.7 kDa |
Protein Sequence |
>RC208999 protein sequence
Red=Cloning site Green=Tags(s) MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFC DMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTA YAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFR SCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002395 |
RefSeq Size | 1869 |
RefSeq ORF | 765 |
Locus ID | 4239 |
Cytogenetics | 17p11.2 |
Summary | This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419346 | MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434121 | MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419346 | Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4) |
CNY 3,080.00 |
|
LY434121 | Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4), transcript variant 1 |
CNY 3,080.00 |
|
TP308999 | Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), 20 µg |
CNY 2,900.00 |
|
TP331122 | Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), transcript variant 1, 20 µg |
CNY 2,900.00 |