Diazepam Binding Inhibitor (DBI) (NM_020548) Human Mass Spec Standard

Specifications

Product Data
Description	DBI MS Standard C13 and N15-labeled recombinant protein (NP_065438)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC208982
Predicted MW	11.8 kDa
Protein Sequence	Sequence Link (showhide) >RC208982 protein sequence Red=Cloning site Green=Tags(s) MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGK AKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_065438
RefSeq Size	745
RefSeq ORF	312
Synonyms	ACBD1; ACBP; CCK-RP; EP
Locus ID	1622
Cytogenetics	2q14.2
Summary	This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Protein Families	Druggable Genome
Protein Pathways	PPAR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.