CCDC50 (NM_174908) Human Mass Spec Standard
CAT#: PH308965
CCDC50 MS Standard C13 and N15-labeled recombinant protein (NP_777568)
View other "CCDC50" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CCDC50 MS Standard C13 and N15-labeled recombinant protein (NP_777568) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208965 |
Predicted MW | 35.8 kDa |
Protein Sequence |
>RC208965 protein sequence
Red=Cloning site Green=Tags(s) MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQ AQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAY ADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLM AEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYT HFTNQQSSTRHFSKSESSHKGFHYKH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_777568 |
RefSeq Size | 8421 |
RefSeq ORF | 918 |
Synonyms | C3orf6; DFNA44; YMER |
Locus ID | 152137 |
Cytogenetics | 3q28 |
Summary | This gene encodes a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405969 | CCDC50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406391 | CCDC50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405969 | Transient overexpression lysate of coiled-coil domain containing 50 (CCDC50), transcript variant 2 |
CNY 4,840.00 |
|
LY406391 | Transient overexpression lysate of coiled-coil domain containing 50 (CCDC50), transcript variant 1 |
CNY 3,080.00 |
|
TP308965 | Recombinant protein of human coiled-coil domain containing 50 (CCDC50), transcript variant 1, 20 µg |
CNY 2,900.00 |