GSTO2 (NM_183239) Human Mass Spec Standard
CAT#: PH308961
GSTO2 MS Standard C13 and N15-labeled recombinant protein (NP_899062)
View other "GSTO2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | GSTO2 MS Standard C13 and N15-labeled recombinant protein (NP_899062) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208961 |
Predicted MW | 28.3 kDa |
Protein Sequence |
>RC208961 protein sequence
Red=Cloning site Green=Tags(s) MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFG HIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGREC TNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWD PTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_899062 |
RefSeq Size | 1546 |
RefSeq ORF | 729 |
Synonyms | bA127L20.1; GSTO 2-2 |
Locus ID | 119391 |
Cytogenetics | 10q25.1 |
Summary | The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010] |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405234 | GSTO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434025 | GSTO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405234 | Transient overexpression lysate of glutathione S-transferase omega 2 (GSTO2) |
CNY 3,080.00 |
|
LY434025 | Transient overexpression lysate of glutathione S-transferase omega 2 (GSTO2), transcript variant 4 |
CNY 3,080.00 |
|
TP308961 | Recombinant protein of human glutathione S-transferase omega 2 (GSTO2), 20 µg |
CNY 2,900.00 |