GSTM5 (NM_000851) Human Mass Spec Standard
CAT#: PH308900
GSTM5 MS Standard C13 and N15-labeled recombinant protein (NP_000842)
View other "GSTM5" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
Specifications
Product Data | |
Description | GSTM5 MS Standard C13 and N15-labeled recombinant protein (NP_000842) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208900 |
Predicted MW | 25.5 kDa |
Protein Sequence |
>RC208900 representing NM_000851
Red=Cloning site Green=Tags(s) MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKI TQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSE FLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFG KSATWNSK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000842 |
RefSeq Size | 1567 |
RefSeq ORF | 654 |
Synonyms | GSTM5-5; GTM5 |
Locus ID | 2949 |
Cytogenetics | 1p13.3 |
Summary | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. [provided by RefSeq, Jul 2008] |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424493 | GSTM5 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424493 | Transient overexpression lysate of glutathione S-transferase mu 5 (GSTM5) |
CN¥ 3,080.00 |
|
TP308900 | Recombinant protein of human glutathione S-transferase mu 5 (GSTM5), 20 µg |
CN¥ 2,900.00 |