TXN (NM_003329) Human Mass Spec Standard
CAT#: PH308876
TXN MS Standard C13 and N15-labeled recombinant protein (NP_003320)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | TXN MS Standard C13 and N15-labeled recombinant protein (NP_003320) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208876 |
Predicted MW | 11.7 kDa |
Protein Sequence |
>RC208876 protein sequence
Red=Cloning site Green=Tags(s) MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003320 |
RefSeq Size | 886 |
RefSeq ORF | 315 |
Synonyms | TRDX; TRX; TRX1; Trx80 |
Locus ID | 7295 |
Cytogenetics | 9q31.3 |
Summary | The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418748 | TXN HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY418748 | Transient overexpression lysate of thioredoxin (TXN) |
CN¥ 3,080.00 |
|
TP308876 | Recombinant protein of human thioredoxin (TXN), 20 µg |
CN¥ 2,900.00 |
|
TP720851 | Purified recombinant protein of Human thioredoxin (TXN) |
CN¥ 3,140.00 |