RbAp48 (RBBP4) (NM_005610) Human Mass Spec Standard
CAT#: PH308761
RBBP4 MS Standard C13 and N15-labeled recombinant protein (NP_005601)
View other "RbAp48" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RBBP4 MS Standard C13 and N15-labeled recombinant protein (NP_005601) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208761 |
Predicted MW | 47.7 kDa |
Protein Sequence |
>RC208761 protein sequence
Red=Cloning site Green=Tags(s) MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGT HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCII ATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLS FNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKI GEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP EGQGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005601 |
RefSeq Size | 7943 |
RefSeq ORF | 1275 |
Synonyms | lin-53; NURF55; RBAP48 |
Locus ID | 5928 |
Cytogenetics | 1p35.1 |
Summary | This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417190 | RBBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417190 | Transient overexpression lysate of retinoblastoma binding protein 4 (RBBP4), transcript variant 1 |
CNY 3,080.00 |
|
TP308761 | Recombinant protein of human retinoblastoma binding protein 4 (RBBP4), transcript variant 1, 20 µg |
CNY 2,900.00 |