Glutathione S Transferase alpha 1 (GSTA1) (NM_145740) Human Mass Spec Standard
CAT#: PH308750
GSTA1 MS Standard C13 and N15-labeled recombinant protein (NP_665683)
View other "Glutathione S Transferase alpha 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GSTA1 MS Standard C13 and N15-labeled recombinant protein (NP_665683) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208750 |
Predicted MW | 25.6 kDa |
Protein Sequence |
>RC208750 protein sequence
Red=Cloning site Green=Tags(s) MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA ILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVL KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE KSLEEARKIFRF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_665683 |
RefSeq Size | 1276 |
RefSeq ORF | 666 |
Synonyms | GST-epsilon; GST2; GSTA1-1; GTH1 |
Locus ID | 2938 |
Cytogenetics | 6p12.2 |
Summary | This gene encodes a member of a family of enzymes that function to add glutathione to target electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. This action is an important step in detoxification of these compounds. This subfamily of enzymes has a particular role in protecting cells from reactive oxygen species and the products of peroxidation. Polymorphisms in this gene influence the ability of individuals to metabolize different drugs. This gene is located in a cluster of similar genes and pseudogenes on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407870 | GSTA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407870 | Transient overexpression lysate of glutathione S-transferase alpha 1 (GSTA1) |
CNY 3,080.00 |
|
TP308750 | Recombinant protein of human glutathione S-transferase alpha 1 (GSTA1), 20 µg |
CNY 2,900.00 |
其它Glutathione S Transferase alpha 1产品