DDR2 (NM_001014796) Human Mass Spec Standard
CAT#: PH308745
DDR2 MS Standard C13 and N15-labeled recombinant protein (NP_001014796)
View other "DDR2" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DDR2 MS Standard C13 and N15-labeled recombinant protein (NP_001014796) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208745 |
Predicted MW | 96.7 kDa |
Protein Sequence |
>RC208745 protein sequence
Red=Cloning site Green=Tags(s) MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP SFQEIHLLLLQQGDE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001014796 |
RefSeq Size | 3252 |
RefSeq ORF | 2565 |
Synonyms | MIG20a; NTRKR3; TKT; TYRO10; WRCN |
Locus ID | 4921 |
Cytogenetics | 1q23.3 |
Summary | This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416820 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423080 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425366 | DDR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416820 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 2 |
CNY 3,080.00 |
|
LY423080 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1 |
CNY 3,080.00 |
|
LY425366 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1 |
CNY 4,840.00 |
|
PH311389 | DDR2 MS Standard C13 and N15-labeled recombinant protein (NP_006173) |
CNY 19,520.00 |
|
TP308745 | Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311389 | Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP700162 | Purified recombinant protein of human discoidin domain receptor tyrosine kinase 2(DDR2), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP710142 | Recombinant protein of human discoidin domain receptor tyrosine kinase 2 (DDR2), transcript variant 1, residues 22-399aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |