RASL10A (NM_001007279) Human Mass Spec Standard
CAT#: PH308743
RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_001007280)
View other "RASL10A" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_001007280) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208743 |
Predicted MW | 12.5 kDa |
Protein Sequence |
>RC208743 protein sequence
Red=Cloning site Green=Tags(s) MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPG GPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001007280 |
RefSeq Size | 1813 |
RefSeq ORF | 345 |
Synonyms | RRP22 |
Locus ID | 10633 |
Cytogenetics | 22q12.2 |
Summary | Potent inhibitor of cellular proliferation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416619 | RASL10A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423485 | RASL10A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416619 | Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 1 |
CNY 3,080.00 |
|
LY423485 | Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 2 |
CNY 3,080.00 |
|
PH305271 | RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_006468) |
CNY 19,520.00 |
|
TP305271 | Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP308743 | Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它RASL10A产品