RASL10A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RASL10A antibody: synthetic peptide directed towards the N terminal of human RASL10A. Synthetic peptide located within the following region: PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	RAS like family 10 member A
Database Link	NP_006468 Entrez Gene 10633 Human UniProt ID Q92737
Background	The specific function of RASL10A is not yet known.
Synonyms	RRP22
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.