United States
Germany
Japan
United Kingdom
China
UBE2C (NM_007019) Human Mass Spec Standard
CAT＃: PH308741
UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_008950)
View other "UBE2C" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_008950) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208741 |
| Predicted MW | 19.7 kDa |
| Protein Sequence |
>RC208741 protein sequence
Red=Cloning site Green=Tags(s) MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAA GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLG EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008950 |
| RefSeq Size | 864 |
| RefSeq ORF | 537 |
| Synonyms | dJ447F3.2; UBCH10 |
| Locus ID | 11065 |
| Cytogenetics | 20q13.12 |
| Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013] |
| Protein Families | Druggable Genome |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405592 | UBE2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416256 | UBE2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405592 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4 |
CNY 3,080.00 |
|
| LY416256 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1 |
CNY 3,080.00 |
|
| PH300240 | UBE2C MS Standard C13 and N15-labeled recombinant protein (NP_861517) |
CNY 19,520.00 |
|
| TP300240 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP308741 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP312704 | Recombinant protein of human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 5, 20 µg |
CNY 2,900.00 |
