Calcium independent Phospholipase A2 (PLA2G6) (NM_001004426) Human Mass Spec Standard
CAT#: PH308735
PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_001004426)
View other "Calcium independent Phospholipase A2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_001004426) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208735 |
Predicted MW | 84.1 kDa |
Protein Sequence |
>RC208735 protein sequence
Red=Cloning site Green=Tags(s) MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFR LFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRI ISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAV AGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIH SKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHG NTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRQLQDLMHISRARKPAFILGSMRDEK RTHDHLLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRM KDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFN QNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKV KKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVG IQYFRLNPQLGTDIMLDEVSDTVLVNALWETEVYIYEHREEFQKLIQLLLSP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001004426 |
RefSeq Size | 3077 |
RefSeq ORF | 2256 |
Synonyms | CaI-PLA2; GVI; INAD1; iPLA2; IPLA2-VIA; iPLA2beta; NBIA2; NBIA2A; NBIA2B; PARK14; PLA2; PNPLA9 |
Locus ID | 8398 |
Cytogenetics | 22q13.1 |
Summary | The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date. [provided by RefSeq, Dec 2010] |
Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400377 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418601 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400377 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 2 |
CNY 3,080.00 |
|
LY418601 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1 |
CNY 3,080.00 |
|
PH307546 | PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_003551) |
CNY 19,520.00 |
|
TP307546 | Recombinant protein of human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP308735 | Recombinant protein of human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Calcium independent Phospholipase A2产品