HIP2 (UBE2K) (NM_005339) Human Mass Spec Standard
CAT#: PH308645
UBE2K MS Standard C13 and N15-labeled recombinant protein (NP_005330)
View other "HIP2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UBE2K MS Standard C13 and N15-labeled recombinant protein (NP_005330) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208645 |
Predicted MW | 22.2 kDa |
Protein Sequence |
>RC208645 representing NM_005339
Red=Cloning site Green=Tags(s) MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNP PKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEM FKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005330 |
RefSeq Size | 2208 |
RefSeq ORF | 600 |
Synonyms | E2-25K; HIP2; HYPG; LIG; UBC1 |
Locus ID | 3093 |
Cytogenetics | 4p14 |
Summary | The protein encoded by this gene belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington's disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417371 | UBE2K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426354 | UBE2K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417371 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 1 |
CNY 3,080.00 |
|
LY426354 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3 |
CNY 3,080.00 |
|
TP308645 | Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720163 | Recombinant protein of human ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast) (UBE2K), transcript variant 3 |
CNY 3,710.00 |
|
TP720982 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2K (UBE2K), transcript variant 1 |
CNY 4,260.00 |