PFDN3 (VBP1) (NM_003372) Human Mass Spec Standard
CAT#: PH308482
VBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003363)
View other "PFDN3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | VBP1 MS Standard C13 and N15-labeled recombinant protein (NP_003363) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208482 |
Predicted MW | 22.6 kDa |
Protein Sequence |
>RC208482 protein sequence
Red=Cloning site Green=Tags(s) MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQK KRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEA QALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003363 |
RefSeq Size | 1643 |
RefSeq ORF | 591 |
Synonyms | HIBBJ46; PFD3; PFDN3; VBP-1 |
Locus ID | 7411 |
Cytogenetics | Xq28 |
Summary | The protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. The encoded protein functions as a chaperone protein, and may play a role in the transport of the Von Hippel-Lindau protein from the perinuclear granules to the nucleus or cytoplasm. Alternative splicing and the use of alternate transcription start sites results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418727 | VBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418727 | Transient overexpression lysate of von Hippel-Lindau binding protein 1 (VBP1) |
CNY 3,080.00 |
|
TP308482 | Recombinant protein of human von Hippel-Lindau binding protein 1 (VBP1), 20 µg |
CNY 2,900.00 |