Staufen (STAU1) (NM_017453) Human Mass Spec Standard
CAT#: PH308387
STAU1 MS Standard C13 and N15-labeled recombinant protein (NP_059347)
View other "Staufen" proteins (13)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | STAU1 MS Standard C13 and N15-labeled recombinant protein (NP_059347) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208387 |
Predicted MW | 63 kDa |
Protein Sequence |
>RC208387 representing NM_017453
Red=Cloning site Green=Tags(s) MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAES ITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNG KGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGP PHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPE YGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLE ILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM VPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPS EQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQS TEMPRTGNGPMSVCGRC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_059347 |
RefSeq Size | 3688 |
RefSeq ORF | 1731 |
Synonyms | PPP1R150; STAU |
Locus ID | 6780 |
Cytogenetics | 20q13.13 |
Summary | Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. [provided by RefSeq, Apr 2020] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413756 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC413757 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC413758 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC417883 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC421948 | STAU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY413756 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2 |
CN¥ 4,840.00 |
|
LY413757 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T3 |
CN¥ 3,080.00 |
|
LY413758 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T1 |
CN¥ 4,840.00 |
|
LY417883 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T4 |
CN¥ 3,080.00 |
|
LY421948 | Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T5 |
CN¥ 4,840.00 |
|
TP308387 | Recombinant protein of human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T3, 20 µg |
CN¥ 2,900.00 |
|
TP760787 | Purified recombinant protein of Human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CN¥ 2,040.00 |
|
TP761139 | Purified recombinant protein of Human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CN¥ 2,040.00 |
其它Staufen产品