BLCAP (NM_006698) Human Mass Spec Standard
CAT#: PH308259
BLCAP MS Standard C13 and N15-labeled recombinant protein (NP_006689)
View other "BLCAP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BLCAP MS Standard C13 and N15-labeled recombinant protein (NP_006689) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208259 |
Predicted MW | 9.7 kDa |
Protein Sequence |
>RC208259 representing NM_006698
Red=Cloning site Green=Tags(s) MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHC SDSPLPESAHDPGVVGT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006689 |
RefSeq Size | 2057 |
RefSeq ORF | 261 |
Synonyms | BC10 |
Locus ID | 10904 |
Cytogenetics | 20q11.23 |
Summary | This gene encodes a protein that reduces cell growth by stimulating apoptosis. Alternative splicing and the use of alternative promoters result in multiple transcript variants encoding the same protein. This gene is imprinted in brain where different transcript variants are expressed from each parental allele. Transcript variants initiating from the upstream promoter are expressed preferentially from the maternal allele, while transcript variants initiating downstream of the interspersed NNAT gene (GeneID:4826) are expressed from the paternal allele. Transcripts at this locus may also undergo A to I editing, resulting in amino acid changes at three positions in the N-terminus of the protein. [provided by RefSeq, Nov 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416478 | BLCAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416478 | Transient overexpression lysate of bladder cancer associated protein (BLCAP), transcript variant 1 |
CNY 3,080.00 |
|
TP308259 | Recombinant protein of human bladder cancer associated protein (BLCAP), 20 µg |
CNY 2,900.00 |