E2F1 (NM_005225) Human Mass Spec Standard
CAT#: PH308247
E2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005216)
View other "E2F1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | E2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005216) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208247 |
Predicted MW | 46.7 kDa |
Protein Sequence |
>RC208247 representing NM_005225
Red=Cloning site Green=Tags(s) MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQ APRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFL ELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDL RQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSE NFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSL LSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG IRDLFDCDFGDLTPLDF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005216 |
RefSeq Size | 2486 |
RefSeq ORF | 1311 |
Synonyms | E2F-1; RBAP1; RBBP3; RBP3 |
Locus ID | 1869 |
Cytogenetics | 20q11.22 |
Summary | The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Non-overlapping Control of Transcriptome by Promoter- and Super-Enhancer-Associated Dependencies in Multiple Myeloma
,null,
Cell reports
,PubMed ID 30590042
[E2F1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417432 | E2F1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417432 | Transient overexpression lysate of E2F transcription factor 1 (E2F1) |
CNY 3,080.00 |
|
TP308247 | Recombinant protein of human E2F transcription factor 1 (E2F1), 20 µg |
CNY 2,900.00 |