ETFBKMT (NM_173802) Human Mass Spec Standard
CAT#: PH308154
C12orf72 MS Standard C13 and N15-labeled recombinant protein (NP_776163)
View other "ETFBKMT" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | C12orf72 MS Standard C13 and N15-labeled recombinant protein (NP_776163) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208154 |
Predicted MW | 29.5 kDa |
Protein Sequence |
>RC208154 protein sequence
Red=Cloning site Green=Tags(s) MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSSGSLTPEIQLR LLTPRCKFWWERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASR ILANDIDPIAGMAITLNCELNRLNPFPILIQNILNLEQDKWDLVVLGDMFYDEDLADSLHQWLKKCFWTY RTRVLIGDPGRPQFSGHSIQHHLHKVVEYSLLESTRQENSGLTTSTVWGFQP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_776163 |
RefSeq Size | 2183 |
RefSeq ORF | 786 |
Synonyms | C12orf72; ETFB-KMT; METTL20 |
Locus ID | 254013 |
Cytogenetics | 12p11.21 |
Summary | Protein-lysine methyltransferase that selectively trimethylates the flavoprotein ETFB in mitochondria (PubMed:25023281, PubMed:25416781). Thereby, may negatively regulate the function of ETFB in electron transfer from Acyl-CoA dehydrogenases to the main respiratory chain (PubMed:25416781).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406414 | METTL20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427724 | METTL20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427725 | METTL20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406414 | Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 1 |
CNY 3,080.00 |
|
LY427724 | Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 2 |
CNY 3,080.00 |
|
LY427725 | Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 3 |
CNY 3,080.00 |
|
TP308154 | Recombinant protein of human chromosome 12 open reading frame 72 (C12orf72), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760722 | Purified recombinant protein of Human methyltransferase like 20 (METTL20), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP761472 | Purified recombinant protein of Human methyltransferase like 20 (METTL20), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2,040.00 |
其它ETFBKMT产品