FAM119A (METTL21A) (NM_145280) Human Mass Spec Standard
CAT#: PH307629
FAM119A MS Standard C13 and N15-labeled recombinant protein (NP_660323)
View other "FAM119A" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | FAM119A MS Standard C13 and N15-labeled recombinant protein (NP_660323) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207629 |
Predicted MW | 24.6 kDa |
Protein Sequence |
>RC207629 protein sequence
Red=Cloning site Green=Tags(s) MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQ KRNQKEDL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660323 |
RefSeq Size | 4748 |
RefSeq ORF | 654 |
Synonyms | FAM119A; HCA557b; HSPA-KMT |
Locus ID | 151194 |
Cytogenetics | 2q33.3 |
Summary | Protein-lysine methyltransferase that selectively trimethylates residues in heat shock protein 70 (HSP70) family members. Contributes to the in vivo trimethylation of Lys residues in HSPA1 and HSPA8. In vitro methylates 'Lys-561' in HSPA1, 'Lys-564' in HSPA2, 'Lys-585' in HSPA5, 'Lys-563' in HSPA6 and 'Lys-561' in HSPA8.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408004 | METTL21A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426777 | METTL21A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408004 | Transient overexpression lysate of family with sequence similarity 119, member A (FAM119A), transcript variant 1 |
CNY 3,080.00 |
|
LY426777 | Transient overexpression lysate of family with sequence similarity 119, member A (FAM119A), transcript variant 2 |
CNY 3,080.00 |
|
TP307629 | Recombinant protein of human family with sequence similarity 119, member A (FAM119A), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760710 | Purified recombinant protein of Human methyltransferase like 21A (METTL21A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它FAM119A产品