D aspartate oxidase (DDO) (NM_003649) Human Mass Spec Standard
CAT#: PH307622
DDO MS Standard C13 and N15-labeled recombinant protein (NP_003640)
View other "D aspartate oxidase" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DDO MS Standard C13 and N15-labeled recombinant protein (NP_003640) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207622 |
Predicted MW | 41 kDa |
Protein Sequence |
>RC207622 protein sequence
Red=Cloning site Green=Tags(s) MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDT TSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV VLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVVNC SGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSR EILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAA RLVSECVHALRTPIPKSNL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003640 |
RefSeq Size | 1733 |
RefSeq ORF | 1107 |
Synonyms | DASOX; DDO-1; DDO-2 |
Locus ID | 8528 |
Cytogenetics | 6q21 |
Summary | The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2019] |
Protein Pathways | Alanine, aspartate and glutamate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401207 | DDO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418289 | DDO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401207 | Transient overexpression lysate of D-aspartate oxidase (DDO), transcript variant 1 |
CNY 3,080.00 |
|
LY418289 | Transient overexpression lysate of D-aspartate oxidase (DDO), transcript variant 2 |
CNY 3,080.00 |
|
TP307622 | Recombinant protein of human D-aspartate oxidase (DDO), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP761486 | Purified recombinant protein of Human D-aspartate oxidase (DDO), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2,040.00 |
其它D aspartate oxidase产品