TFF1 (NM_003225) Human Mass Spec Standard
CAT#: PH307599
TFF1 MS Standard C13 and N15-labeled recombinant protein (NP_003216)
View other "TFF1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | TFF1 MS Standard C13 and N15-labeled recombinant protein (NP_003216) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207599 |
Predicted MW | 9.15 kDa |
Protein Sequence |
>RC207599 representing NM_003225
Red=Cloning site Green=Tags(s) MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY PNTIDVPPEEECEF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003216 |
RefSeq Size | 508 |
RefSeq ORF | 252 |
Synonyms | BCEI; D21S21; HP1.A; HPS2; pNR-2; pS2 |
Locus ID | 7031 |
Cytogenetics | 21q22.3 |
Summary | Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418822 | TFF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418822 | Transient overexpression lysate of trefoil factor 1 (TFF1) |
CNY 3,080.00 |
|
TP307599 | Purified recombinant protein of Homo sapiens trefoil factor 1 (TFF1), 20 µg |
CNY 2,900.00 |