TFF1 (NM_003225) Human Tagged ORF Clone
CAT#: RC207599
TFF1 (Myc-DDK-tagged)-Human trefoil factor 1 (TFF1)
ORF Plasmid: tGFP
"NM_003225" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BCEI; D21S21; HP1.A; HPS2; pNR-2; pS2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC207599 representing NM_003225
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCACCATGGAGAACAAGGTGATCTGCGCCCTGGTCCTGGTGTCCATGCTGGCCCTCGGCACCCTGG CCGAGGCCCAGACAGAGACGTGTACAGTGGCCCCCCGTGAAAGACAGAATTGTGGTTTTCCTGGTGTCAC GCCCTCCCAGTGTGCAAATAAGGGCTGCTGTTTCGACGACACCGTTCGTGGGGTCCCCTGGTGCTTCTAT CCTAATACCATCGACGTCCCTCCAGAAGAGGAGTGTGAATTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207599 representing NM_003225
Red=Cloning site Green=Tags(s) MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY PNTIDVPPEEECEF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_003225 |
ORF Size | 252 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003225.3 |
RefSeq Size | 508 bp |
RefSeq ORF | 255 bp |
Locus ID | 7031 |
UniProt ID | P04155 |
Domains | PD |
Protein Families | Druggable Genome, Secreted Protein |
MW | 9.15 kDa |
Gene Summary | Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Trefoil factor 1 (TFF1) is a potential prognostic biomarker with functional significance in breast cancers
,Yi, J;Ren, L;Li, D;Wu, J;Li, W;Du, G;Wang, J;,
Biomed. Pharmacother.
,PubMed ID 31986408
[TFF1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC207599L1 | Lenti ORF clone of Human trefoil factor 1 (TFF1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC207599L2 | Lenti ORF clone of Human trefoil factor 1 (TFF1), mGFP tagged |
CNY 5,890.00 |
|
RC207599L3 | Lenti ORF clone of Human trefoil factor 1 (TFF1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC207599L4 | Lenti ORF clone of Human trefoil factor 1 (TFF1), mGFP tagged |
CNY 3,600.00 |
|
RG207599 | TFF1 (tGFP-tagged) - Human trefoil factor 1 (TFF1) |
CNY 2,800.00 |
|
SC118099 | TFF1 (untagged)-Human trefoil factor 1 (TFF1) |
CNY 1,200.00 |