beta 2 Microglobulin (B2M) (NM_004048) Human Mass Spec Standard
CAT#: PH307587
B2M MS Standard C13 and N15-labeled recombinant protein (NP_004039)
View other "beta 2 Microglobulin" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | B2M MS Standard C13 and N15-labeled recombinant protein (NP_004039) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207587 |
Predicted MW | 13.71 kDa |
Protein Sequence |
>RC207587 representing NM_004048
Red=Cloning site Green=Tags(s) MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE HSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004039 |
RefSeq Size | 987 |
RefSeq ORF | 357 |
Synonyms | IMD43 |
Locus ID | 567 |
Cytogenetics | 15q21.1 |
Summary | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.[provided by RefSeq, Aug 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401311 | B2M HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401311 | Transient overexpression lysate of beta-2-microglobulin (B2M) |
CNY 3,080.00 |
|
TP307587 | Recombinant protein of human beta-2-microglobulin (B2M), 20 µg |
CNY 2,900.00 |
|
TP710178 | Recombinant protein of human beta-2-microglobulin (B2M), residues 21-119aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720425 | Recombinant protein of human beta-2-microglobulin (B2M) |
CNY 3,140.00 |
|
TP750209 | Purified recombinant protein of human beta-2-microglobulin(B2M), Ile21-Met119, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它beta 2 Microglobulin产品