GCLM (NM_002061) Human Mass Spec Standard
CAT#: PH307224
GCLM MS Standard C13 and N15-labeled recombinant protein (NP_002052)
View other "GCLM" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GCLM MS Standard C13 and N15-labeled recombinant protein (NP_002052) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207224 |
Predicted MW | 30.7 kDa |
Protein Sequence |
>RC207224 protein sequence
Red=Cloning site Green=Tags(s) MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVL ECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSL EHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQ LLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002052 |
RefSeq Size | 3074 |
RefSeq ORF | 822 |
Synonyms | GLCLR |
Locus ID | 2730 |
Cytogenetics | 1p22.1 |
Summary | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Glutathione metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400752 | GCLM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400752 | Transient overexpression lysate of glutamate-cysteine ligase, modifier subunit (GCLM) |
CNY 3,080.00 |
|
TP307224 | Recombinant protein of human glutamate-cysteine ligase, modifier subunit (GCLM), 20 µg |
CNY 2,900.00 |