MEK3 (MAP2K3) (NM_145109) Human Mass Spec Standard
CAT#: PH307115
MAP2K3 MS Standard C13 and N15-labeled recombinant protein (NP_659731)
View other "MEK3" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | MAP2K3 MS Standard C13 and N15-labeled recombinant protein (NP_659731) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207115 |
Predicted MW | 39.3 kDa |
Protein Sequence |
>RC207115 protein sequence
Red=Cloning site Green=Tags(s) MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISEL GRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICM ELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFG ISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQ VVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_659731 |
RefSeq Size | 2319 |
RefSeq ORF | 1041 |
Synonyms | MAPKK3; MEK3; MKK3; PRKMK3; SAPKK-2; SAPKK2 |
Locus ID | 5606 |
Cytogenetics | 17p11.2 |
Summary | The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403425 | MAP2K3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403425 | Transient overexpression lysate of mitogen-activated protein kinase kinase 3 (MAP2K3), transcript variant B |
CN¥ 3,080.00 |
|
PH318101 | MAP2K3 MS Standard C13 and N15-labeled recombinant protein (NP_002747) |
CN¥ 19,520.00 |
|
TP307115 | Recombinant protein of human mitogen-activated protein kinase kinase 3 (MAP2K3), transcript variant B, 20 µg |
CN¥ 2,900.00 |
|
TP318101 | Recombinant protein of human mitogen-activated protein kinase kinase 3 (MAP2K3), transcript variant A, 20 µg |
CN¥ 2,900.00 |